pentapeptide raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2025-09-23 and is reviewed periodically as new material appears.
At the receptor level, ipamorelin binds GHS-R1a and triggers signaling through Gq-coupled pathways. Activation leads to calcium release and downstream effects in pituitary somatotroph cells. These events promote the release of growth hormone into circulation. The response depends on the presence of the receptor and on the physiological state of the animal or tissue studied. Because the receptor is also found in other tissues, effects beyond the pituitary have been examined in laboratory models, though the extent of those effects remains an area of ongoing study.
One distinguishing feature reported in animal studies is selectivity. Ipamorelin stimulated growth hormone release with limited elevation of adrenocorticotropic hormone or cortisol compared with earlier secretagogues such as GHRP-6. This pattern has been described as more selective for the growth hormone axis. The finding comes mainly from preclinical work, and the degree to which it holds across species and doses is not fully settled. Reports also describe effects on gastric motility in animal models, suggesting activity outside the pituitary, though the clinical relevance of this observation is uncertain.
Compared with other secretagogues such as GHRP-2, GHRP-6, and hexarelin, ipamorelin is described as more selective. Published animal work reports little or no increase in adrenocorticotropic hormone, cortisol, or prolactin at doses that release growth hormone. This selectivity is the property most often cited in the research literature. Whether the same profile holds across species and dosing schedules remains an open question, since human data are limited and come largely from small studies.
Ipamorelin is a synthetic pentapeptide that belongs to the growth hormone secretagogue family. Its sequence is Aib-His-D-2-Nal-D-Phe-Lys-NH2, and its molecular mass is approximately 711.9 daltons. The compound was described in the late 1990s by researchers seeking molecules that release growth hormone with fewer side effects than earlier secretagogues. It is a laboratory and research compound, not an approved medicine in most jurisdictions.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic pentapeptide | Chain of five amino acid residues |
| Molecular mass | Approximately 712 Da | Consistent with a five-residue chain |
| Receptor target | GHS-R1a | Growth hormone secretagogue receptor |
| Primary action | Growth hormone release | Pituitary somatotroph stimulation |
| Research origin | Developed in the 1990s | Small-peptide secretagogue program |
Structural features distinguish the molecule from earlier secretagogues. An alpha-aminoisobutyric acid residue near the N-terminus and a D-naphthylalanine substitution increase receptor affinity, while C-terminal amidation improves resistance to exopeptidases. These modifications are associated with reduced stimulation of appetite and of the hypothalamic-pituitary-adrenal axis compared with hexarelin or growth hormone releasing peptide-6. Whether the same profile applies at every dose level studied is a matter of ongoing investigation rather than settled consensus.
Ipamorelin is a synthetic pentapeptide that acts as an agonist at the ghrelin receptor, also called the growth hormone secretagogue receptor type 1a. Its sequence incorporates non-natural residues, which slows enzymatic breakdown relative to short native peptides. In laboratory and early clinical work the compound is described as a selective growth hormone secretagogue because it raises growth hormone with comparatively little effect on other pituitary outputs. The degree to which that selectivity holds across species and dosing regimens remains an open question in the published literature.
In animal and early human studies, ipamorelin produces pulsatile growth hormone release and a secondary rise in insulin-like growth factor 1. The magnitude and duration of that rise depend on route, sampling schedule, and the baseline endocrine state of the subject. Whether repeated exposure alters the response over time is not firmly settled, since some reports describe stable pulsatility while others note attenuation. Most published data come from small samples, which limits the strength of any general claim about long-term behavior.
Ipamorelin is a synthetic pentapeptide that belongs to the growth hormone secretagogue class of compounds. Its sequence is Aib-His-D-2-Nal-D-Phe-Lys-NH2, a structure that differs from natural ghrelin in length and in the presence of non-natural amino acid residues. Early laboratory work described it as a comparatively selective agent that stimulates growth hormone release with limited effect on other pituitary hormones. The compound is supplied as a lyophilized solid for research use and has no identified natural source in the body.
Activity is mediated mainly through the growth hormone secretagogue receptor, now generally called the ghrelin receptor or GHS-R1a. Binding at this G-protein-coupled receptor triggers phospholipase C signaling, calcium mobilization, and release of growth hormone from pituitary somatotrophs. Reports describe less pronounced stimulation of adrenocorticotropic hormone and prolactin compared with earlier secretagogues such as hexarelin or GHRP-6. Selectivity figures vary between assay systems, so the degree of separation from other secretagogues is an area of ongoing comparison rather than a fixed constant.
Identity and purity are assessed by complementary methods rather than a single test. Reversed-phase high-performance liquid chromatography separates the peptide from related impurities and reports a percentage purity. Mass spectrometry, most often with electrospray ionization, confirms the expected molecular mass and detects sequence-related variants. Amino acid analysis can verify composition, while water content and residual counterion measurements support the mass balance of a batch. Stability studies under accelerated conditions are used to estimate shelf life, though such estimates carry uncertainty for long-term storage.
Material supplied for research use is normally a white to off-white lyophilized powder. The solid is hygroscopic and is handled in a low-humidity environment to limit water uptake. Bulk quantities are frequently shipped in sealed vials under inert gas. Once reconstituted in water or a neutral buffer, the solution is less stable than the dry powder and is usually divided into single-use aliquots.
Long-term storage of the dry powder is typically at minus twenty degrees Celsius or lower, protected from light and moisture. Solutions are commonly kept frozen and thawed only once, because repeated freeze-thaw cycles can promote aggregation and loss of measurable peptide content. Buffers near neutral pH are preferred over strongly acidic or strongly basic conditions. Shipping at ambient temperature is acceptable for short periods when the powder remains sealed and desiccated.
=== Since 1994 === A new interim constitution, introduced in 1994 after four years of negotiation, finally introduced all-race democracy and enfranchised men and women of all races on equal terms, the minimum age remaining 18 years. Parliament was reconstituted to consist of a Senate and a National Assembly.
== Diversity == There are a large number of different odor receptors, with as many as 2,000 in the mammalian genome which, depending on the species represents up to 5% of the coding-genes in the genome. However, not all of these potential odor receptor genes are expressed and functional. According to an analysis of data derived from the Human Genome Project, humans have approximately 400 functional genes coding for olfactory receptors, and the remaining 600 candidates are pseudogenes. The reason for the large number of different odor receptors is to provide a system for discriminating between as many different odors as possible. Even so, each odor receptor does not detect a single odor. Rather each individual odor receptor is broadly tuned to be activated by a number of similar odorant structures. Analogous to the immune system, the diversity that exists within the olfactory receptor family allows molecules that have never been encountered before to be characterized. However, unlike the immune system, which generates diversity through in-situ recombination, every single olfactory receptor is translated from a specific gene; hence the large portion of the genome devoted to encoding OR genes. Furthermore, most odors activate more than one type of odor receptor. Since the number of combinations and permutations of olfactory receptors is very large, the olfactory receptor system is capable of detecting and distinguishing between a very large number of odorant molecules.
HN MAPRGESCLLLLTSEIDLPVKRRA S1 MCHWAGGASNTGDARGDVFGKQAG S2 MGVKFFTLSTREFPSVQRAVPLWTNS S3 MLGYNFSSFPCGTISIAPGENFYRLYFIWVNGLAKVVW S4 MLEVMELVNRRGKICRVPETFFNLSL S5 MYCSEVGFCSEVAPTEIFNAGLWV S6 MLDQDIPMVQPLLKVRLEND
Cell junctions, protein complexes that provide contact between cells and neighbouring cells or the extracellular matrix, are especially abundant in epithelial tissues. They build up the paracellular barrier of epithelia and control the paracellular transport. There are five main types of cell junctions: tight junctions, adherens junctions, desmosomes, hemidesmosomes, and gap junctions.
=== Pornography, black men, and penis size === While more than 46% of people have watched pornography, with 30%–90% of women and 60%–98% of men having watched it at some point in their lifespan, between 1973 and 2016, among and in comparison to other racial groups, Black women and Black men were reported to have watched the most porn. Pornography tends to depict Black people through racist and sexist stereotypes, such as Black people being hypersexual and animalistic, and sexually objectifies Black people through its emphasis and focus on sexual vigor and genitalia; this is socially generated and reinforced through production and supply of porn, such as Black porn and interracial porn that initially debuted in 1982 and big Black cock (BBC) porn, which then meets the demand from porn consumers, such as White men with fantasies about the sexuality of Black people in 1982 and porn consumers on Pornhub whose top search terms in 2022 were: "Black", the 13th most searched term, "BBC", the 9th most searched term, and "Ebony", the 3rd most searched term and the most searched category of 2022. Cosmetic changes and digital changes to genitalia can occur in porn, with the Labia minora of women being portrayed as smaller than the average size and the penis of men being portrayed as larger than the average size. Genital self-image is affected by the consumption of pornography as the primary focus of pornography is on genitalia and sexual acts.
Sources: en.wikipedia.org
== Epidemiology == Gynecomastia is the most common benign disorder of the male breast tissue and affects 35 percent of men, being most prevalent between the ages of 50 and 69. New cases of gynecomastia are common in three age populations: newborns, adolescents, and men older than 50 years. Newborn gynecomastia occurs in about 60–90 percent of male babies, and most cases resolve on their own in about 2–3 weeks after delivery. During adolescence, on average, 33 percent of males are estimated to exhibit signs of gynecomastia. Gynecomastia in older men is estimated to be present in 24–65 percent of men between the ages of 50 and 80. Estimates on asymptomatic gynecomastia are about up to 70% in men aged 50 to 69 years. The prevalence of gynecomastia in men may have increased in recent years, but the epidemiology of the disorder is not fully understood. The use of anabolic steroids and exposure to chemicals that mimic estrogen in cosmetic products, organochlorine pesticides, and industrial chemicals have been suggested as possible factors driving this increase. According to the American Society of Plastic Surgeons, breast reduction surgeries to correct gynecomastia are fairly common but has been a recent decline. In 2020, there were over 18,000 procedures of this type performed in the United States, which is down 11% from 2019.
==== Treatment ==== Treatment should resolve reversible pulpitis; early treating may help prevent irreversible pulpitis Follow-up required to determine whether the reversible pulpitis has returned to a normal status
== Initial proposal and development == Neutron capture therapy (NCT) was first proposed in the literature in 1936 by Gordon L. Locher, who observed that isotopes with large neutron capture cross sections, such as boron-10, could be accumulated in cancerous tissue and bombarded with thermal neutrons to induce destruction of the cancerous cells. Boron was seen as a qualified candidate for NCT because the alpha particles of 10B (4He2+), produced from boron's reaction with a neutron beam, can induce apoptosis with a relatively tight travel radius about the diameter of a cell. The proposition was that boron-10 containing delivery agents would take advantage of properties of cancer cells that are not present in normal tissue cells, such as overexpression of certain enzymes or the lack of blood brain barrier. This idea was attractive because it had the potential to be more selective than traditional chemo- and radiotherapies. However, BNCT requires a neutron beam to act as a source of thermal neutrons and a suitable boron-delivery agent; neither was available at the time of Locher's suggestion. Therefore, it was not until the 1950s, when nuclear reactors were available, that Locher's proposal was put into practice. Since neutrons have a low penetration range, only about 2–3 cm below the skin's surface, BNCT was proposed for head and neck cancers.
Compared to the United States, which has a greater supply of molybdenum in the soil, people living in those areas have about 16 times greater risk for esophageal squamous cell carcinoma. Molybdenum deficiency has also been reported as a consequence of non-molybdenum supplemented total parenteral nutrition (complete intravenous feeding) for long periods of time. It results in high blood levels of sulfite and urate, in much the same way as molybdenum cofactor deficiency. Since pure molybdenum deficiency from this cause occurs primarily in adults, the neurological consequences are not as marked as in cases of congenital cofactor deficiency. A congenital molybdenum cofactor deficiency disease, seen in infants, is an inability to synthesize molybdenum cofactor, the heterocyclic molecule discussed above that binds molybdenum at the active site in all known human enzymes that use molybdenum. The resulting deficiency results in high levels of sulfite and urate, and neurological damage.
=== 2 December === Ukrainian Presidential Advisor Mykhailo Podolyak claimed that 10–13,000 Ukrainian soldiers have been killed since 24 February, the figure last given in August was 9,000. The Ukrainians struck a Russian concentration near Starobilsk, in the rear area of Luhansk Oblast, reportedly killing 14 Russian personnel and wounding 30.
Sources: en.wikipedia.org
The complete blood count is interpreted by comparing the output to reference ranges, which represent the results found in 95% of apparently healthy people. Based on a statistical normal distribution, the tested samples' ranges vary with sex and age. On average, adult females have lower hemoglobin, hematocrit, and red blood cell count values than males; the difference lessens, but is still present, after menopause. CBC results for children and newborn babies differ from those of adults. Newborns' hemoglobin, hematocrit, and red blood cell count are extremely high to compensate for low oxygen levels in the womb and the high proportion of fetal hemoglobin, which is less effective at delivering oxygen to tissues than mature forms of hemoglobin, inside their red blood cells. The MCV is also increased, and the white blood cell count is elevated with a preponderance of neutrophils. The red blood cell count and related values begin to decline shortly after birth, reaching their lowest point at about two months of age and increasing thereafter. The red blood cells of older infants and children are smaller, with a lower MCH, than those of adults. In the paediatric white blood cell differential, lymphocytes often outnumber neutrophils, while in adults neutrophils predominate. Other differences between populations may affect the reference ranges: for example, people living at higher altitudes have higher hemoglobin, hematocrit, and RBC results, and people of African heritage have lower white blood cell counts on average.
== Etymology == The genus name, Salvia, was first used by Pliny for a plant that was likely Salvia officinalis (common sage) and is derived from the Latin salvere. The specific epithet, divinorum, was given because of the plant's traditional use in divination. It is often loosely translated as "diviner's sage" or "seer's sage". Albert Hofmann, who collected the first plants with Gordon Wasson, objected to the new plant being given the name divinorum: "I was not very happy with the name because Salvia divinorum means 'Salvia of the ghosts,' whereas Salvia divinatorum, the correct name, means 'Salvia of the priests'." It is now in the botanical literature under the name Salvia divinorum due to priority rules.
Biomimetics is a field that aims to produce materials and systems that replicate those present in nature. In the context of tissue engineering, this is a common approach used by engineers to create materials for these applications that are comparable to native tissues in terms of their structure, properties, and biocompatibility. Material properties are largely dependent on physical, structural, and chemical characteristics of that material. Subsequently, a biomimetic approach to system design will become significant in material integration, and a sufficient understanding of biological processes and interactions will be necessary. Replication of biological systems and processes may also be used in the synthesis of bio-inspired materials to achieve conditions that produce the desired biological material. Therefore, if a material is synthesized having the same characteristics of biological tissues both structurally and chemically, then ideally the synthesized material will have similar properties. This technique has an extensive history originating from the idea of using natural phenomenon as design inspiration for solutions to human problems. Many modern advancements in technology have been inspired by nature and natural systems, including aircraft, automobiles, architecture, and even industrial systems. Advancements in nanotechnology initiated the application of this technique to micro- and nano-scale problems, including tissue engineering.
The water then traveled through the channels into sixteen fountains known as the "stairway of fountains", reserving the first water source for the Emperor. This incredible feat supplied the population of Machu Picchu, which varied between 300 and 1000 people when the emperor was present and also helped irrigate water to the farming steppes. The fountains and canal system were built so well that they would, after a few minor repairs, still work today. To go along with the Incas' advanced water supply system, an equally impressive drainage system was built as well. Machu Picchu contains nearly 130 outlets in the center that moved the water out of the city through walls and other structures. The agriculture terraces are a feature of the complicated drainage system; the steppes helped avoid erosion and were built on a slope to aim excess water into channels that ran alongside the stairways. These channels carried the runoff into the main drain, avoiding the main water supply. This carefully planned drainage system shows the Incas' concern and appreciation for clean water. Water engineer Ken Wright and his archaeological team found the emperor’s bathing room complete with a separate drain that carried off his used bath water so it would never re-enter Machu Picchu’s water supply.
The Tumpo Triangle campaign exposed several flaws in the planning of the South African defence chiefs and general staff. They had estimated quite accurately that their forces would be able to inflict a crushing defeat on FAPLA in the flood plains and open terrain south of Cuito Cuanavale. But they had not anticipated so many Angolan units would survive and establish strong defensive lines in the Tumpo Triangle, or that the addition of Cuban troops there would stiffen the resistance considerably. Further South African miscalculations appeared in the latter phases of the campaign. One was the assumption that the small and highly mobile but lightly armed SADF expeditionary force was suited to mounting frontal attacks on well-prepared defenders supported by dug in artillery west of Cuito. The use of battalions trained and organised for mobile warfare in this manner was in violation of the SADF's own mechanised doctrine. The defending Angolans had ample dug-in artillery and the benefit of air cover: the Soviet Union's increased willingness to supply FAPLA with advanced fighter aircraft and even Soviet pilots on loan posed a serious threat to South African air operations over Cuito Cuanavale. As Soviet involvement grew, and the number of air battles increased, South Africa's air force began encountering MiG-23s flown by well-trained Soviet pilots. Furthermore, Angolan pilots newly trained under Soviet supervision at Lubango were proving more capable of challenging South African fighters.
Sources: en.wikipedia.org
It acts on the growth hormone secretagogue receptor, GHS-R1a, which is also the receptor for ghrelin. Binding triggers intracellular signaling that promotes growth hormone release from the pituitary. The interaction is the basis for its classification as a secretagogue.
In animal studies it showed greater selectivity for growth hormone release, with less effect on cortisol and adrenocorticotropic hormone than compounds such as GHRP-6. This selectivity is one of the most frequently cited features in preclinical literature. Whether the same profile applies in other contexts is not fully established.
The receptor-level events are reasonably well described, but the full range of downstream effects is not. Studies have reported activity in tissues beyond the pituitary, including the gut. How these observations translate across species and conditions remains an open question.
Ipamorelin is a synthetic pentapeptide that stimulates growth hormone release by activating the ghrelin receptor. It is handled as a research tool rather than as a licensed therapeutic product. Its short chain length makes it comparatively simple to synthesize and analyze.